PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa17g023690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 690aa    MW: 76614 Da    PI: 6.6693
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa17g023690.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-192879556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++t++q+++Le+ F+++++p++++r++L+++lgL  rq+k+WFqNrR+++k
  Csa17g023690.1 28 HRHTPHQIQRLESTFNECQHPDEKQRTQLSRELGLAPRQIKFWFQNRRTQKK 79
                    689**********************************************988 PP

2START150.71.2e-472184392206
                     HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddke...qWdetlakaetle 83 
                     +a +a++el+k+ + +ep+W       + +n + +  +f++s +        ++ea+r sgvv+ ++  lv  l+d+ +    +   +a+ +tl+
  Csa17g023690.1 218 IAVTAMEELLKLLQTNEPLWINTDgsrDVLNLESYENIFPRSSTsggkknnLRMEASRSSGVVFTNALILVDMLMDSVKsadLFPSIVAASKTLA 312
                     7889*****************999888999999******9999999******************************99999************** PP

                     EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
           START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvd 171
                     vissg       al+lm  elq+lsplv+ R+f ++Ry++q + g+w+i+ vS + +q++++     R+ ++pSg+li+++sng+skvtwveh++
  Csa17g023690.1 313 VISSGlrgnhgDALHLMIEELQVLSPLVAtREFCVLRYCQQIEHGTWAIANVSYEFPQFVSQ----SRSYRFPSGCLIQDMSNGYSKVTWVEHAE 403
                     ************************************************************95....56666************************ PP

                     --SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 172 lkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                      +++ p h++++  v++gla+ga +w +tlqr ce+
  Csa17g023690.1 404 FEEQEPiHEIFKDSVHKGLAFGAERWISTLQRMCER 439
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.67E-19981IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-211075IPR009057Homeodomain-like
PROSITE profilePS5007117.7672181IPR001356Homeobox domain
SMARTSM003891.9E-182285IPR001356Homeobox domain
PfamPF000465.1E-172879IPR001356Homeobox domain
CDDcd000863.19E-182882No hitNo description
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PROSITE profilePS5084848.127208442IPR002913START domain
SuperFamilySSF559611.51E-30209440No hitNo description
CDDcd088753.72E-104212438No hitNo description
SMARTSM002341.1E-36217439IPR002913START domain
PfamPF018525.4E-40218439IPR002913START domain
Gene3DG3DSA:3.30.530.202.3E-7272436IPR023393START-like domain
SuperFamilySSF559612.06E-21460680No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010091Biological Processtrichome branching
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MNMEFFGDSQ NHDGSETDKK NKKKKRFHRH TPHQIQRLES TFNECQHPDE KQRTQLSREL  60
GLAPRQIKFW FQNRRTQKKA QHERADNCAL KEENDKIRCE NIAIREAIKH AICPNCGDSP  120
LNDDAYFDEQ KLRIENAQLR DELERVSSIA AKFIGRPISH LPPLLNPMHV SPLELFHSGP  180
SLDFDLLPGS CSSMAVPNLP SQPNLVLSEM DKSLMTNIAV TAMEELLKLL QTNEPLWINT  240
DGSRDVLNLE SYENIFPRSS TSGGKKNNLR MEASRSSGVV FTNALILVDM LMDSVKSADL  300
FPSIVAASKT LAVISSGLRG NHGDALHLMI EELQVLSPLV ATREFCVLRY CQQIEHGTWA  360
IANVSYEFPQ FVSQSRSYRF PSGCLIQDMS NGYSKVTWVE HAEFEEQEPI HEIFKDSVHK  420
GLAFGAERWI STLQRMCERF TNLLEPATSS LELGGVIPSP EGKRSIMRLA HRMVSNFCFS  480
VGTSHNTRST VVSGLDEFAV RVTSRKSRHE PNGMVLCAAT SFWLPNSPQN VFNFLKDERT  540
RPQWDVLSNG NSVQEVANIT NGSNPGNCIS VLRGFNASSS AQNNMLILQE SCIDSSGAAL  600
VIYTPVDIPA LNIAMSGQDT SCIPILPSGF AITPDGSSKG GSLITVGFQI MVSGMQPAKL  660
NMESMETVNN LINTTVHQIK TTLNCPSTA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4934650.0AB493465.1 Arabidopsis thaliana At1g17920 mRNA for hypothetical protein, partial cds, clone: RAAt1g17920.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010476956.10.0PREDICTED: homeobox-leucine zipper protein HDG12
SwissprotQ9LMT80.0HDG12_ARATH; Homeobox-leucine zipper protein HDG12
TrEMBLR0IBH00.0R0IBH0_9BRAS; Uncharacterized protein
STRINGAT1G17920.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.10.0homeodomain GLABROUS 12